PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00066.113
Common NameAMTR_s00066p00120340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 308aa    MW: 33375.4 Da    PI: 9.8848
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00066.113genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.81e-44441431100
                                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 
                                               +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++ +reda++sl+yeAear+
  evm_27.model.AmTr_v1.0_scaffold00066.113  44 PCAACKFLRRKCTPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNDLHPAQREDAVNSLAYEAEARL 112
                                               7******************************************************************** PP

                                    DUF260  70 rdPvyGavgvilklqqqleqlkaelallkee 100
                                               rdPvyG+vgvi+ lq ql+ql+ +l+++++e
  evm_27.model.AmTr_v1.0_scaffold00066.113 113 RDPVYGCVGVISMLQIQLKQLQGDLVRARAE 143
                                               *************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.54143144IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-4444141IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MFDIQHHHHQ PQPQRRRRDD TATAMMAAAP SSSSSSSSVP CNSPCAACKF LRRKCTPECV  60
FAPYFPPDQP QKFANVHKVF GASNVTKLLN DLHPAQREDA VNSLAYEAEA RLRDPVYGCV  120
GVISMLQIQL KQLQGDLVRA RAELSKYINA GLAAAVAQQQ HLQQHGLVGL RGAVYDGHNG  180
GYEGGIVAVG LGGGGGGLGP LNQFGGGVGR GEERGGRRWC RDWVRRRILV RYVLLSLSLS  240
LSLTLSLHPQ FYPPKSMSMA LWLQSSFALG LALILFGALS PLENGTIFLS RSLGSGFFYL  300
FRLSLSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006858730.21e-101PREDICTED: LOB domain-containing protein 6
SwissprotO044799e-60LBD6_ARATH; LOB domain-containing protein 6
TrEMBLU5DFG50.0U5DFG5_AMBTC; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.48e-52LBD family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]